Pfam domain
Pfam family: GTP_EFTU (PF00009.26)
Uniprot AC: P36048
RecName: Pre-mRNA-splicing factor SNU114
Begin-End: 131-442
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLS
IKLNGSTLLCTDLESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVE
QLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTKGNVFSPIDNN
IIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGNFRTKPFENVEKY
PTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPFLKHVLQLIFR
QQTGLVDAITRC
Structures of the domain P36048 131-442
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 C 132-323 None
5gmk X-ray 3.4 C 74-380 None
6bk8 X-ray 3.3 B 75-323 None
5lj3 X-ray 3.8 C 132-323 None
5mps X-ray 3.85 C 305-323 None
5lj5 X-ray 3.8 C 132-323 None
3jcm X-ray 3.8 H 31-323 None
5gam X-ray 3.7 C 132-323 None


© NPIDB team 2003 - 2020

text