Pfam domain
Pfam family: GTP_EFTU_D2 (PF03144.24)
Uniprot AC: P36048
RecName: Pre-mRNA-splicing factor SNU114
Begin-End: 481-578
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
AEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDEDDETPSCEVE
EIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLY
Structures of the domain P36048 481-578
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 C 482-578 None
5gmk X-ray 3.4 C 567-578 None
6bk8 X-ray 3.3 B 482-578 None
5lj3 X-ray 3.8 C 482-578 None
5mps X-ray 3.85 C 482-578 None
5lj5 X-ray 3.8 C 482-578 None
3jcm X-ray 3.8 H 482-578 None
5gam X-ray 3.7 C 482-578 None


© NPIDB team 2003 - 2020

text