Pfam domain
Pfam family: EFG_IV (PF03764.17)
Uniprot AC: P36048
RecName: Pre-mRNA-splicing factor SNU114
Begin-End: 738-854
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DGIMDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLPDEISPELLSKYKEQIIQ
GFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAI
Structures of the domain P36048 738-854
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 C 743-853 None
5gmk X-ray 3.4 C 743-853 None
6bk8 X-ray 3.3 B 743-853 None
3jcm X-ray 3.8 H 743-853 None


© NPIDB team 2003 - 2019

text