Pfam domain
Pfam family: EFG_IV (PF03764.17)
Uniprot AC: P36048
RecName: Pre-mRNA-splicing factor SNU114
Begin-End: 744-854
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLPDEISPELLSKYKEQIIQGFYWAV
KEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAI
Structures of the domain P36048 744-854
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lj3 X-ray 3.8 C 744-853 None
5mps X-ray 3.85 C 744-853 None
5lj5 X-ray 3.8 C 744-853 None
5gam X-ray 3.7 C 744-853 None


© NPIDB team 2003 - 2019

text