Pfam domain
Pfam family: EFG_C (PF00679.23)
Uniprot AC: P36048
RecName: Pre-mRNA-splicing factor SNU114
Begin-End: 856-948
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLLEVRGQVPVIESAGFE
TDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKD
Structures of the domain P36048 856-948
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 C 856-947 None
5gmk X-ray 3.4 C 856-947 None
6bk8 X-ray 3.3 B 856-947 None
5lj3 X-ray 3.8 C 856-947 None
5mps X-ray 3.85 C 856-947 None
5lj5 X-ray 3.8 C 856-947 None
3jcm X-ray 3.8 H 856-947 None
5gam X-ray 3.7 C 856-947 None


© NPIDB team 2003 - 2019

text