Pfam domain
Pfam family: Ebp2 (PF05890.11)
Uniprot AC: P36049
RecName: rRNA-processing protein EBP2
Begin-End: 196-261
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NNTKAMKHALERVQLPWKKHSFQEHQSVTSETNTDEHIKDIYDDTERELAFYKQSLDAVL
VARDEL
Structures of the domain P36049 196-261
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 J 196-261 None
6em3 X-ray 3.2 J 196-261 None


© NPIDB team 2003 - 2019

text