Pfam domain
Pfam family: Ebp2 (PF05890.11)
Uniprot AC: P36049
RecName: rRNA-processing protein EBP2
Begin-End: 196-327
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NNTKAMKHALERVQLPWKKHSFQEHQSVTSETNTDEHIKDIYDDTERELAFYKQSLDAVL
VARDELKRLKVPFKRPLDYFAEMVKSDEHMDKIKGKLIEEASDKKAREEARRQRQLKKFG
KQVQNATLQKRQ
Structures of the domain P36049 196-327
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 J 196-327 None


© NPIDB team 2003 - 2019

text