Pfam domain
Pfam family: RRN3 (PF05327.13)
Uniprot AC: P36070
RecName: RNA polymerase I-specific transcription initiation factor RRN3
Begin-End: 48-614
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SAAMYSRFVKSALDDLDKNDSTQIGIIANQVALPSKNPERINDKNLNILLDILSSNINRI
ESSRGTFLIQSIINFEKWWELPPHTLSKYIYFIKILCSSIPKWWQDVSMILVSCFILPIK
QTVCHHDMLKYFLRMIPSSMGFIDTYLAKFFPNKNDTRRKLVNYTSNLLKLRGYCSELGF
QIWSLLIEKIISIDVELQNELDELDDDVDDDDLEEVDLEDDDDLDDDSGDDDDENCGNSN
EELRSGAADGSQSDSEDMDIIEGMDGTEEYNVELTQGIKELSTKLDSILTLVSTHVEEQV
TPESLESGEGVGVFNTLTTLFKTHVLPTYYTRSIQYIMFHVSQQQLELMDSFLVTLIDIS
FAVNEAAEKKIKSLQYLGSYIARAKKLSRTQIIFVASYLTSWLNRYVIEREEEVDQRGGM
ERFKHFYAAFQALCYIFCFRHNIFRDTDGNWECELDKFFQRMVISKFNPLKFCNENVMLM
FARIAQQESVAYCFSIIENNNNERLRGIIGKADSDKKENSAQANTTSSSWSLATRQQFID
LQSYFPYDPLFLKNYKILMKEYYIEWS
Structures of the domain P36070 48-614
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rrd X-ray 3.1 O 48-614 None
6rql X-ray 2.9 O 48-614 None
6rwe X-ray 3 O 48-614 None
6rui X-ray 2.7 O 48-614 None


© NPIDB team 2003 - 2021

text