Pfam domain
Pfam family: Ribosomal_L14e (PF01929.16)
Uniprot AC: P36105
RecName: 60S ribosomal protein L14-A
Begin-End: 54-128
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALT
DFERFQVMVLRKQKR
Structures of the domain P36105 54-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 M 54-128 None
6em3 X-ray 3.2 M 54-128 None
6em5 X-ray 4.3 M 176-250 None


© NPIDB team 2003 - 2019

text