Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: P36419
RecName: Aspartate--tRNA(Asp) ligase
Begin-End: 19-101
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
VVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVVRAKGLVRLR
PEPNPRLATGRVEVELSALEVLA
Structures of the domain P36419 19-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1efw X-ray 3 A 19-101 None
1efw X-ray 3 B 19-101 None


© NPIDB team 2003 - 2021

text