Pfam domain
Pfam family: DUF331 (PF03889.12)
Uniprot AC: P36675
RecName: Alternative ribosome-rescue factor A
Begin-End: 3-46
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHG
Structures of the domain P36675 3-46
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u4j X-ray 3.7 w 9-45 None


© NPIDB team 2003 - 2019

text