Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.15)
Uniprot AC: P36954
RecName: DNA-directed RNA polymerase II subunit RPB9
Begin-End: 14-51
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS
Structures of the domain P36954 14-51
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 I 14-50 None
5iya X-ray 5.4 I 14-50 None
5iy8 X-ray 7.9 I 14-50 None
5iyd X-ray 3.9 I 14-50 None
5iy6 X-ray 7.2 I 14-50 None
5iyc X-ray 3.9 I 14-50 None
5iy9 X-ray 6.3 I 14-50 None
5iyb X-ray 3.9 I 14-50 None


© NPIDB team 2003 - 2019

text