Pfam domain
Pfam family: TFIIS_C (PF01096.17)
Uniprot AC: P36954
RecName: DNA-directed RNA polymerase II subunit RPB9
Begin-End: 84-124
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWT
Structures of the domain P36954 84-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 I 84-124 None
5iya X-ray 5.4 I 84-124 None
5iy8 X-ray 7.9 I 84-124 None
5iyd X-ray 3.9 I 84-124 None
5iy6 X-ray 7.2 I 84-124 None
5iyc X-ray 3.9 I 84-124 None
5iy9 X-ray 6.3 I 84-124 None
5iyb X-ray 3.9 I 84-124 None


© NPIDB team 2003 - 2019

text