Pfam domain
Pfam family: SRP_SPB (PF02978.18)
Uniprot AC: P37105
RecName: Signal recognition particle protein
Begin-End: 330-427
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
TLDDFLEQLGQVRNMGPLDELLQMMPGAGKMKGLKNIQVDEKQLNHVEAIIKSMTVLEKE
QPDIINASRRKRIAKGSGTSVQEVNRLLKQFDEMKKMM
Structures of the domain P37105 330-427
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ue4 X-ray 7 C 330-427 None


© NPIDB team 2003 - 2019

text