Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P37231
RecName: Peroxisome proliferator-activated receptor gamma
Begin-End: 137-205
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
IECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQ
KCLAVGMSH
Structures of the domain P37231 137-205
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3dzu X-ray 3.2 D 110-176  H-Bb H-Mj S-Bb L-Bb 
3dzy X-ray 3.1 D 110-176  H-Bb H-Mj S-Bb L-Bb 
3e00 X-ray 3.1 D 110-176  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text