Pfam domain
Pfam family: ResIII (PF04851.14)
Uniprot AC: P37954
RecName: UvrABC system protein B
Begin-End: 10-140
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
KYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTL
AGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSA
LFERRDVIIIA
Structures of the domain P37954 10-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nmv X-ray 2.95 A 12-138 None
2d7d X-ray 2.1 A 12-138 None
3v4r X-ray 3.25 A 12-138 None
3v4r X-ray 3.25 B 12-138 None


© NPIDB team 2003 - 2019

text