Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P37954
RecName: UvrABC system protein B
Begin-End: 430-545
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
QIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIR
DLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNA
Structures of the domain P37954 430-545
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nmv X-ray 2.95 A 440-544 None
2d7d X-ray 2.1 A 440-544 None
3v4r X-ray 3.25 B 440-544 None
3v4r X-ray 3.25 A 440-544 None


© NPIDB team 2003 - 2019

text