Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: P38011
RecName: Guanine nucleotide-binding protein subunit beta-like protein
Begin-End: 8-46
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWK
Structures of the domain P38011 8-46
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 g 54-91 None
1trj X-ray 11.7 A 56-93 None


© NPIDB team 2003 - 2019

text