Pfam domain
Pfam family: Ribosomal_L32e (PF01655.17)
Uniprot AC: P38061
RecName: 60S ribosomal protein L32
Begin-End: 14-121
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISQPKIGYGSNKKTKFLSPSGHKT
FLVANVKDLETLTMHTKTYAAEIAHNISAKNRVVILARAKALGIKVTN
Structures of the domain P38061 14-121
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 e 14-121 None
6em3 X-ray 3.2 e 14-121 None
6em5 X-ray 4.3 e 12-138 None


© NPIDB team 2003 - 2019

text