Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P38203
RecName: U6 snRNA-associated Sm-like protein LSm2
Begin-End: 5-72
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRG
STVRYVYL
Structures of the domain P38203 5-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 B 6-70 None
6aso X-ray 2.71 B 6-70 None
4m7a X-ray 2.78 I 6-70 None
4m7a X-ray 2.78 B 6-70 None
4m7a X-ray 2.78 I 6-70 None
4m7a X-ray 2.78 B 6-70 None
4m7d X-ray 2.6 I 6-70 None
4m7d X-ray 2.6 B 6-70 None
3jcm X-ray 3.8 c -1-70 None


© NPIDB team 2003 - 2019

text