Pfam domain
Pfam family: Bystin (PF05291.10)
Uniprot AC: P38333
RecName: Essential nuclear protein 1
Begin-End: 205-465
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ALPEKVIKAYTTVGSILKTWTHGKLPKLFKVIPSLRNWQDVIYVTNPEEWSPHVVYEATK
LFVSNLTAKESQKFINLILLERFRDNIETSEDHSLNYHIYRAVKKSLYKPSAFFKGFLFP
LVETGCNVREATIAGSVLAKVSVPALHSSAALSYLLRLPFSPPTTVFIKILLDKKYALPY
QTVDDCVYYFMRFRILDDGSNGEDATRVLPVIWHKAFLTFAQRYKNDITQDQRDFLLETV
RQRGHKDIGPEIRRELLAGAS
Structures of the domain P38333 205-465
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 i 206-466 None
6eml X-ray 3.6 e 206-463 None


© NPIDB team 2003 - 2019

text