Pfam domain
Pfam family: Ribosomal_S10 (PF00338.21)
Uniprot AC: P38701
RecName: 40S ribosomal protein S20
Begin-End: 23-117
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTWETY
EMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVV
Structures of the domain P38701 23-117
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 U 23-116 None


© NPIDB team 2003 - 2019

text