Pfam domain
Pfam family: Brix (PF04427.17)
Uniprot AC: P38805
RecName: Ribosome production factor 1
Begin-End: 101-269
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VNAKKSAYEFANILIEILPNVTFVKRKFGYKLKEISDICIKRNFTDIVIINEDKKKVTGL
TFIHLPEGPTFYFKLSSFVEVKKIVGHGRPTSHIPELILNNFQTRLGQTVGRLFQSILPQ
NPDIEGRQVITLHNQRDYIFFRRHRYVFKDNERVGLQELGPQFTLKLKR
Structures of the domain P38805 101-269
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 x 109-268 None
6em3 X-ray 3.2 x 109-268 None
6em5 X-ray 4.3 x 109-268 None


© NPIDB team 2003 - 2019

text