Pfam domain
Pfam family: ORC6 (PF05460.15)
Uniprot AC: P38826
RecName: Origin recognition complex subunit 6
Begin-End: 271-416
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFI
VFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFD
GIRYDEIIFRKLGSMLQTTNILVTDD
Structures of the domain P38826 271-416
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 F 271-416  L-Bb L-Mj 
6wgg X-ray 8.1 F 271-416 None
6wgi X-ray 10 F 271-416 None
5v8f X-ray 3.9 F 271-416 None
6wgc X-ray 4.3 F 271-416 None


© NPIDB team 2003 - 2021

text