Pfam domain
Pfam family: eIF-1a (PF01176.18)
Uniprot AC: P38912
RecName: Eukaryotic translation initiation factor 1A
Begin-End: 32-94
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDV
VHK
Structures of the domain P38912 32-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j80 X-ray 3.75 i 32-94 None
3jam X-ray 3.46 i 32-94 None
3jaq X-ray 6 i 13-75 None
3j81 X-ray 4 i 29-91 None
3jap X-ray 4.9 i 29-91 None


© NPIDB team 2003 - 2019

text