Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P38996
RecName: Nuclear polyadenylated RNA-binding protein 3
Begin-End: 332-395
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFG
KKLI
Structures of the domain P38996 332-395
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xnr X-ray 1.6 A 332-388 None
2l41 NMR A 5-61 None


© NPIDB team 2003 - 2019

text