Pfam domain
Pfam family: 7kD_DNA_binding (PF02294.17)
Uniprot AC: P39476
RecName: DNA-binding protein 7d
Begin-End: 3-61
Organism: Sulfolobus solfataricus
Interaction Mode:  L-Bb L-Mn 

Sequence:
TVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEK
Structures of the domain P39476 3-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bbx NMR D 2-60  L-Bb L-Mn 
1bbx NMR C 2-60  L-Bb L-Mn 
1c8c X-ray 1.45 A 3-61 None
1bnz X-ray 2 A 3-61 None


© NPIDB team 2003 - 2019

text