Pfam domain
Pfam family: RecU (PF03838.16)
Uniprot AC: P39792
RecName: Holliday junction resolvase RecU
Begin-End: 31-194
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
RGMTLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTDYN
GIYKGRYIDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGICFVIISAFDQVYFLEAD
KLFYFWDRKEKNGRKSIRKDELEETAYPISLGYAPRIDYISIIE
Structures of the domain P39792 31-194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fdk X-ray 3.21 D 31-194  L-Mj L-Mn 
5fdk X-ray 3.21 B 34-194  S-Bb S-Mj L-Bb 
5fdk X-ray 3.21 A 31-194  S-Bb S-Mj L-Bb L-Mj L-Mn 
5fdk X-ray 3.21 C 31-194  S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text