Pfam domain
Pfam family: CAT_RBD (PF03123.14)
Uniprot AC: P39805
RecName: Transcription antiterminator LicT
Begin-End: 1-55
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV
Structures of the domain P39805 1-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1l1c NMR B 1-54 None
1l1c NMR A 1-54 None


© NPIDB team 2003 - 2019

text