Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P39990
RecName: 13 kDa ribonucleoprotein-associated protein
Begin-End: 18-112
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVP
YVFVPSRVALGRACGVSRPVIAASITTNDASAIKT
Structures of the domain P39990 18-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 M 19-110 None
5tzs X-ray 5.1 e 19-110 None
5tzs X-ray 5.1 f 19-110 None
5gap X-ray 3.6 K 19-110 None


© NPIDB team 2003 - 2020

text