Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P40018
RecName: Small nuclear ribonucleoprotein-associated protein B
Begin-End: 10-97
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKD
GTTLNIKVEKRVLGLTILRGEQILSTVV
Structures of the domain P40018 10-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 F 11-96 None
5wsg X-ray 4 k 9-96 None
5gmk X-ray 3.4 s 11-96 None
5gmk X-ray 3.4 k 11-96 None
6bk8 X-ray 3.3 f 11-96 None
6bk8 X-ray 3.3 k 11-96 None
5lj3 X-ray 3.8 k 39-119 None
5lj3 X-ray 3.8 b 11-96 None
5mps X-ray 3.85 b 11-96 None
5lj5 X-ray 3.8 k 11-96 None
5lj5 X-ray 3.8 b 11-96 None
3jcm X-ray 3.8 O 11-96 None
3jcm X-ray 3.8 S 11-96 None
5gam X-ray 3.7 b 11-96 None
5uz5 X-ray 3.56 K 11-96 None
5gao X-ray 3.6 k 11-96 None


© NPIDB team 2003 - 2019

text