Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P40070
RecName: U6 snRNA-associated Sm-like protein LSm4
Begin-End: 5-81
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAV
KLNEIYIRGTFIKFIKL
Structures of the domain P40070 5-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 D 6-80 None
6aso X-ray 2.71 D 6-74 None
4m7a X-ray 2.78 N 6-80 None
4m7a X-ray 2.78 G 6-80 None
4m7a X-ray 2.78 N 6-80 None
4m7a X-ray 2.78 G 6-80 None
4m7d X-ray 2.6 N 6-80 None
4m7d X-ray 2.6 G 6-80 None
3jcm X-ray 3.8 h 6-80 None


© NPIDB team 2003 - 2019

text