Pfam domain
Pfam family: Ribosomal_S8e (PF01201.21)
Uniprot AC: P40078
RecName: Ribosome biogenesis protein NSA2
Begin-End: 18-260
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LDHEERKRKREARESHKISERAQKLTGWKGKQFAKKRYAEKVSMRKKIKAHEQSKVKGSS
KPLDTDGDALPTYLLDREQNNTAKAISSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVI
KTGKSRSKSWKRMITKHTFVGEGFTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPI
LAVKKNPQSPMYTQLGVLTKGTIIEVNVSELGMVTAGGKVVWGKYAQVTNEPDRDGCVNA
VLL
Structures of the domain P40078 18-260
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 r 32-260 None


© NPIDB team 2003 - 2019

text