Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P40089
RecName: U6 snRNA-associated Sm-like protein LSm5
Begin-End: 10-83
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHG
RMLLSGNNIAILVP
Structures of the domain P40089 10-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 E 11-83 None
6aso X-ray 2.71 E 11-83 None
4m7a X-ray 2.78 L 11-83 None
4m7a X-ray 2.78 E 11-83 None
4m7a X-ray 2.78 L 11-83 None
4m7a X-ray 2.78 E 11-83 None
4m7d X-ray 2.6 L 11-83 None
4m7d X-ray 2.6 E 11-83 None
3jcm X-ray 3.8 f 35-110 None


© NPIDB team 2003 - 2019

text