Pfam domain
Pfam family: RIO1 (PF01163.21)
Uniprot AC: P40160
RecName: Serine/threonine-protein kinase RIO2
Begin-End: 108-293
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DIYKVSDKNGNPRVMKIHRLGRTSFHSVRNNRDYLKKSNQGANWMHLSRLAANKEYQFMS
MLYSKGFKVPEPFDNSRHIVVMELIEGYPMRRLRKHKNIPKLYSDLMCFIVDLANSGLIH
CDFNEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKKKLKYE
PKPDSS
Structures of the domain P40160 108-293
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 l 127-286 None


© NPIDB team 2003 - 2019

text