Pfam domain
Pfam family: Rio2_N (PF09202.10)
Uniprot AC: P40160
RecName: Serine/threonine-protein kinase RIO2
Begin-End: 8-91
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MRYLTTDDFRVLQAVEQGSRSHEVVPTPLIHQISGMRSQSGTNRAISDLAKLSLISKMRN
VKYDGYRLTYNGIDYLALKTMLNR
Structures of the domain P40160 8-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 l 8-91 None
6eml X-ray 3.6 r 8-91 None


© NPIDB team 2003 - 2019

text