Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P40204
RecName: Small nuclear ribonucleoprotein G
Begin-End: 5-73
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIR
GNSIISLEA
Structures of the domain P40204 5-73
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 K 6-71 None
5wsg X-ray 4 j 6-71 None
5gmk X-ray 3.4 x 6-71 None
5gmk X-ray 3.4 j 6-71 None
6bk8 X-ray 3.3 d 6-71 None
6bk8 X-ray 3.3 n 81-144 None
5lj3 X-ray 3.8 r 6-78 None
5lj3 X-ray 3.8 g 5-64 None
5mps X-ray 3.85 g 6-71 None
5lj5 X-ray 3.8 r 6-78 None
5lj5 X-ray 3.8 g 5-64 None
3jcm X-ray 3.8 a 135-195 None
3jcm X-ray 3.8 X 6-71 None
5gam X-ray 3.7 g 6-71 None
5uz5 X-ray 3.56 Q 6-71 None
5gao X-ray 3.6 r 6-71 None


© NPIDB team 2003 - 2019

text