Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: P40217
RecName: Eukaryotic translation initiation factor 3 subunit I
Begin-End: 42-80
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWD
Structures of the domain P40217 42-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 q 43-80 None
3jap X-ray 4.9 q 45-82 None


© NPIDB team 2003 - 2020

text