Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P40352
RecName: DNA repair and recombination protein RAD26
Begin-End: 651-768
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKG
RQSLVDRFNNESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIG
Structures of the domain P40352 651-768
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vvr X-ray 5.8 M 652-768 None


© NPIDB team 2003 - 2019

text