Pfam domain
Pfam family: STAG (PF08514.13)
Uniprot AC: P40541
RecName: Cohesin subunit SCC3
Begin-End: 214-344
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EFYLLISKENKKRKNFKMGPLYQNFAEFMTKLLEVANDLQLLYVESDEDDTQIVTGNLVL
DLLTWLSSFSVCKIRCFRYISTLTLYLFQDYLTQQAVNLEKNYLAKLSKQLSLEEKKKRP
NNKTLEKLEST
Structures of the domain P40541 214-344
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6h8q X-ray 3.63 B 214-344 None
6h8q X-ray 3.63 A 214-344 None


© NPIDB team 2003 - 2021

text