Pfam domain
Pfam family: Ribosomal_L30 (PF00327.19)
Uniprot AC: P40693
RecName: Ribosome biogenesis protein RLP7
Begin-End: 142-194
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYPLLKVIAPYV
Structures of the domain P40693 142-194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 t 142-194 None
6em3 X-ray 3.2 t 142-194 None
6em5 X-ray 4.3 t 142-194 None


© NPIDB team 2003 - 2019

text