Pfam domain
Pfam family: SH2 (PF00017.26)
Uniprot AC: P40763
RecName: Signal transducer and activator of transcription 3
Begin-End: 584-674
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQ
QLNNMSFAEIIMGYKIMDATNILVSPLVYLY
Structures of the domain P40763 584-674
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6qhd X-ray 2.85 B 584-674 None
6qhd X-ray 2.85 A 584-674 None


© NPIDB team 2003 - 2021

text