Pfam domain
Pfam family: Cep3 (PF16846.7)
Uniprot AC: P40969
RecName: Centromere DNA-binding protein complex CBF3 subunit B
Begin-End: 101-607
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FWMNYLQKDQSFQLMNFAMENLGALYFGSIGDISELYLRVEQYWDRRADKNHSVDGKYWD
ALIWSVFTMCIYYMPVEKLAEIFSVYPLHEYLGSNKRLNWEDGMQLVMCQNFARCSLFQL
KQCDFMAHPDIRLVQAYLILATTTFPYDEPLLANSLLTQCIHTFKNFHVDDFRPLLNDDP
VESIAKVTLGRIFYRLCGCDYLQSGPRKPIALHTEVSSLLQHAAYLQDLPNVDVYREENS
TEVLYWKIISLDRDLDQYLNKSSKPPLKTLDAIRRELDIFQYKVDSLEEDFRSNNSRFQK
FIALFQISTVSWKLFKMYLIYYDTADSLLKVIHYSKVIISLIVNNFHAKSEFFNRHPMVM
QTITRVVSFISFYQIFVESAAVKQLLVDLTELTANLPTIFGSKLDKLVYLTERLSKLKLL
WDKVQLLDSGDSFYHPVFKILQNDIKIIELKNDEMFSLIKGLGSLVPLNKLRQESLLEEE
DENNTEPSDFRTIVEEFQSEYNISDIL
Structures of the domain P40969 101-607
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gys X-ray 4.4 I 101-607 None
6gys X-ray 4.4 C 101-607  H-Bb H-Mj L-Bb 
6gys X-ray 4.4 J 101-341 None
6gys X-ray 4.4 B 101-607 None


© NPIDB team 2003 - 2021

text