Pfam domain
Pfam family: Methyltr_RsmB-F (PF01189.16)
Uniprot AC: P40991
RecName: 25S rRNA (cytosine(2870)-C(5))-methyltransferase
Begin-End: 338-547
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VIALDPHENERILDMAAAPGGKTTYISAMMKNTGCVFANDANKSRTKSLIANIHRLGCTN
TIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQLLL
SAIDSVDCNSKHGGVIVYSTCSVAVEEDEAVIDYALRKRPNVKLVDTGLAIGKEAFTSYR
GKKFHPSVKLARRYYPHTYNVDGFFVAKFQ
Structures of the domain P40991 338-547
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 q 126-547 None


© NPIDB team 2003 - 2019

text