Pfam domain
Pfam family: Ribosomal_S14 (PF00253.20)
Uniprot AC: P41057
RecName: 40S ribosomal protein S29-A
Begin-End: 20-56
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QCRVCSSHTGLIRKYGLNICRQCFREKANDIGFNKFR
Structures of the domain P41057 20-56
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 d 3-37 None


© NPIDB team 2003 - 2019

text