Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P41161
RecName: ETS translocation variant 5
Begin-End: 369-448
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRY
YYEKGIMQKVAGERYVYKFV
Structures of the domain P41161 369-448
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uno X-ray 1.95 A 369-448 None


© NPIDB team 2003 - 2019

text