Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: P41201
RecName: 50S ribosomal protein L5
Begin-End: 27-74
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
NVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAK
Structures of the domain P41201 27-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ns4 X-ray 2.4 A 27-85 None
5ns4 X-ray 2.4 B 27-85 None
5ns3 X-ray 2.4 B 27-85 None
5ns3 X-ray 2.4 A 27-73 None


© NPIDB team 2003 - 2019

text