Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: P41201
RecName: 50S ribosomal protein L5
Begin-End: 27-83
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
NVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLR
Structures of the domain P41201 27-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mji X-ray 2.5 A 27-83 None
1mji X-ray 2.5 B 27-83 None


© NPIDB team 2003 - 2019

text