Pfam domain
Pfam family: SUI1 (PF01253.21)
Uniprot AC: P41214
RecName: Eukaryotic translation initiation factor 2D
Begin-End: 487-567
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQV
QIQGNQVHHLGWLLLEEYQLP
Structures of the domain P41214 487-567
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oa3 X-ray 4.3 0 490-567 None


© NPIDB team 2003 - 2020

text