Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P41235
RecName: Hepatocyte nuclear factor 4-alpha
Begin-End: 58-127
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRL
KKCFRAGMKK
Structures of the domain P41235 58-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4iqr X-ray 2.9 F 50-118  H-Bb H-Mj L-Bb 
4iqr X-ray 2.9 E 50-118  H-Bb H-Mj L-Bb 
4iqr X-ray 2.9 B 50-118 None
4iqr X-ray 2.9 A 50-118 None
3cbb X-ray 2 B 50-118  H-Bb H-Mj L-Bb 
3cbb X-ray 2 A 50-118  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text